Ral GEF with PH domain and SH3 binding motif 2, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human RALGPS2 protein.

Marque: Abnova H00055103-D01P.100ug

Code produit. 16177886

351.00€ / 100µg

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Sequence: MDLMNGQASSVNIAATASEKSSSSESLSDKGSELKKSFDAVVFDVLKVTPEEYAGQITLMDVPVFKAIQPDELSSCGWNKKEKYSSAPNAVAFTRRFNHVSFWVVREILHAQTLKIRAEVLSHYIKTAKKLYELNNLHALMAVVSGLQSAPIFRLTKTWALLSRKDKTTFEKLEYVMSKEDNYKRLRDYISSLKMTPCIPYLGIYLSDLTYIDSAYPSTGSILENEQRSNLMNNILRIISDLQQSCEYDIPMLPHVQKYLNSVQYIEELQKFVEDDNYK

Spécification

Antigène	Ral GEF with PH domain and SH3 binding motif 2
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against a full-length human RALGPS2 protein.
Expression	RALGPS2
Alias de gène	FLJ10244/FLJ25604/KIAA0351/dJ595C2.1
Espèces hôtes	Rabbit
Méthode de purification	Affinity Purified
État réglementaire	RUO
Primaire ou secondaire	Primary
Espèces cibles	Human
Type de produit	Antibody

Applications	Western Blot
Conjugué	Unconjugated
Formule	PBS with no preservative; pH 7.4
Numéro d’ordre du gène	NM_018037
Symboles de gène(s)	RALGPS2
Immunogène	RALGPS2 (NP_060507.1, 1 a.a. ∼ 279 a.a) full-length human protein.
Quantité	100 μg
Disciplines de recherche	Signal Transduction
Identification génétique (Entrez)	55103
Contenu et stockage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Suggestions de produits

Clients qui ont consulté cet article ont également consulté This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-5 of 12

Catalog No. 10399053

Invitrogen ™ Lames de chambre de comptage de c Invitrogen ™ Lames de chambre de comptage de c

141,00 € / 50 pièces
Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500mL
Catalog No. 10671531

Thermo Scientific ™ Étalons de taille Nanosphe Thermo Scientific ™ Étalons de taille Nanosphe

703,00 € / 15mL
Catalog No. 13464189

Thermo Scientific ™ Mélange de trypsine/protéa Thermo Scientific ™ Mélange de trypsine/protéa

105,00 € / 5 pièces
Catalog No. 10647894

Thermo Scientific ™ Solution de substrat pour Thermo Scientific ™ Solution de substrat pour

280,00 € / 250mL
Catalog No. 10116287

Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta

187,00 € / 1mL
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

226,00 € / 100µg
Catalog No. 11570806

Invitrogen ™ Wheat Germ Agglutinin (WGA) Invitrogen ™ Wheat Germ Agglutinin (WGA)

656,00 € / 5mg
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

87,25 € / 100µg
Catalog No. 15137105

Applied Biosystems ™ Systèmes de PCR ProFlex ™ Applied Biosystems ™ Systèmes de PCR ProFlex ™

11.630,00 € / 1 pièce
Catalog No. 10347642

V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge V5 Tag Monoclonal Antibody (SV5-Pk1), Invitroge

345,00 € / 1 pièce
Catalog No. 11514270

Trenbolone Polyclonal Antibody, Invitrogen ™ Trenbolone Polyclonal Antibody, Invitrogen ™

862,00 € / 100µL

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

Ral GEF with PH domain and SH3 binding motif 2, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™ > 100μg; Unlabeled

Votre nom

Votre adresse e-mail *

Type de problème *

Description détaillée du problème/de la demande *

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Annuler Soumettre

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis

Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu

Ral GEF with PH domain and SH3 binding motif 2, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Description

Spécification

Suggestions de produits

Documents

Promotions

Derniers produits consultés...Afficher