missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SLC25A10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Bio-Techne NBP1-85214
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
SLC25A10 Polyclonal specifically detects SLC25A10 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
SLC25A10 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
dicarboxylate ion carrier, DICSolute carrier family 25 member 10, member 10, mitochondrial dicarboxylate carrier, solute carrier family 25 (mitochondrial carrier; dicarboxylate transporter) | |
Rabbit | |
Affinity Purified | |
RUO | |
1468 | |
Human | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
SLC25A10 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:SLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHAL | |
0.1 mL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Suggestions de produits
Clients qui ont consulté cet article ont également consulté
Viewing 1-4 of
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
SLC25A10 Antibody, Novus Biologicals™ > 0.1mL; Unlabeled
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu