missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPRC5A/RAI3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Bio-Techne NBP2-58188
412.00 EUR valable jusqu'au 2025-03-28
Utilisez le code promo "25306" pour bénéficier de cette offre.
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
GPRC5A/RAI3 Polyclonal specifically detects GPRC5A/RAI3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spécification
| GPRC5A/RAI3 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
| G protein-coupled receptor, family C, group 5, member A, GPCR5A, Orphan G-protein-coupling receptor PEIG-1, RAI3G-protein coupled receptor family C group 5 member A, RAIG1RAIG-1, retinoic acid induced 3, retinoic acid responsive, Retinoic acid-induced gene 1 protein, retinoic acid-induced protein 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| GPRC5A | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MATTVPDGCRNGLKSKYYRLCDKAEAWGIVL | |
| 100 μL | |
| GPCR | |
| 9052 | |
| Human | |
| IgG |
Suggestions de produits
Clients qui ont consulté cet article ont également consulté
Viewing 1-5 of 12
-
Catalog No. 10399053
141,00 € / 50 pièces -
Catalog No. 10678484
205,00 € / 500mL -
Catalog No. 10671531
703,00 € / 15mL -
Catalog No. 13464189
105,00 € / 5 pièces -
Catalog No. 10647894
280,00 € / 250mL -
Catalog No. 10116287
187,00 € / 1mL -
Catalog No. 17821163
Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech
226,00 € / 100µg -
Catalog No. 11570806
656,00 € / 5mg -
Catalog No. 17833373
Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech
87,25 € / 100µg -
Catalog No. 15137105
11.630,00 € / 1 pièce -
Catalog No. 10347642
345,00 € / 1 pièce -
Catalog No. 11514270
862,00 € / 100µL
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
GPRC5A/RAI3 Antibody, Novus Biologicals™ > 100μL; Unlabeled
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu