missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPRC5A/RAI3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
359.00€ - 515.00€
Spécification
Antigène | GPRC5A/RAI3 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugué | Unconjugated |
Espèces hôtes | Rabbit |
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
---|---|---|---|---|---|---|---|---|---|
Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
18207073
|
Bio-Techne
NBP2-58188 |
100 μL |
515.00€
100µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
18653038
|
Novus Biologicals
NBP2-58188-25ul |
25 μL |
359.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
GPRC5A/RAI3 Polyclonal specifically detects GPRC5A/RAI3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spécification
GPRC5A/RAI3 | |
Polyclonal | |
Rabbit | |
GPCR | |
G protein-coupled receptor, family C, group 5, member A, GPCR5A, Orphan G-protein-coupling receptor PEIG-1, RAI3G-protein coupled receptor family C group 5 member A, RAIG1RAIG-1, retinoic acid induced 3, retinoic acid responsive, Retinoic acid-induced gene 1 protein, retinoic acid-induced protein 3 | |
GPRC5A | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
9052 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MATTVPDGCRNGLKSKYYRLCDKAEAWGIVL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
GPRC5A/RAI3 Antibody, Novus Biologicals™