Learn More
Invitrogen™ Human CLOCK (aa 543-689) Control Fragment Recombinant Protein
Recombinant Protein
Marque: Invitrogen™ RP100714
Description
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a protein that belongs to the basic helix-loop-helix (bHLH) family of transcription factors. Polymorphisms within the encoded protein have been associated with circadian rhythm sleep disorders. A similar protein in mice is a circadian regulator that acts as a transcription factor and forms a heterodimer with aryl hydrocarbon receptor nuclear translocator-like to activate transcription of mouse period 1.
Spécification
O15516 | |
Blocking Assay, Control | |
9575 | |
100 μL | |
5330400M04Rik; bHLHe8; circadian locomoter output cycles kaput; circadian locomoter output cycles kaput protein; circadian locomoter output cycles protein kaput; circadian locomotor output cycles kaput; class E basic helix-loop-helix protein 8; CLOCK; clock circadian regulator; clock homolog; hCLOCK; I79_020252; KAT13D; KIAA0334; mCLOCK; rCLOCK | |
CLOCK | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CLOCK (aa 543-689) Control Fragment | |
RUO | |
CLOCK | |
Unconjugated | |
Recombinant | |
RQQEELRKIQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQVVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLPSQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Suggestions de produits
Clients qui ont consulté cet article ont également consulté
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.