DNA Ligase III Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Marque: Novus Biologicals NBP2-92719-0.02ml

Afficher plus de versions de ce produit

Code produit. 18696572

198.00€ / 0.02mL

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

DNA Ligase III Polyclonal antibody specifically detects DNA Ligase III in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)

Spécification

Antigène	DNA Ligase III
Classification	Polyclonal
Dilution	Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
Alias de gène	DNA ligase 3, DNA ligase III, EC 6.5.1.1, LIG2, ligase II, DNA, ATP-dependent, ligase III, DNA, ATP-dependent, Polydeoxyribonucleotide synthase [ATP] 3
Immunogène	Recombinant fusion protein containing a sequence corresponding to amino acids 254-460 of human DNA Ligase III (NP_039269.2). CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKEDEQQQALQDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLHNAQE
Quantité	0.02 mL
Disciplines de recherche	Base Excision Repair, Cancer, DNA Repair
Identification génétique (Entrez)	3980
Contenu et stockage	Store at -20°C. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugué	Unconjugated
Formule	PBS with 50% glycerol, pH7.3.
Espèces hôtes	Rabbit
Méthode de purification	Affinity purified
État réglementaire	RUO
Primaire ou secondaire	Primary
Espèces cibles	Human, Mouse, Rat
Forme	Purified

Afficher plus

Suggestions de produits

Customers who viewed this item also viewed. This information does not imply a recommendation or representation of any kind and any action taken upon the information provided is strictly at your own risk. The products shown have not been qualified by Fisher Scientific for any particular purpose, application or use and it is the responsibility of the purchaser to ensure that the performance of the product is suitable for the purchasers specific use or intended application.

Viewing 1-5 of 11

Catalog No. 10399053

Invitrogen ™ Lames de chambre de comptage de c Invitrogen ™ Lames de chambre de comptage de c

141,00 € / 50 pièces
Catalog No. 10678484

Thermo Scientific ™ Pierce ™ BCA Protein Assa Thermo Scientific ™ Pierce ™ BCA Protein Assa

205,00 € / 500mL
Catalog No. 13464189

Thermo Scientific ™ Mélange de trypsine/protéa Thermo Scientific ™ Mélange de trypsine/protéa

105,00 € / 5 pièces
Catalog No. 10647894

Thermo Scientific ™ Solution de substrat pour Thermo Scientific ™ Solution de substrat pour

280,00 € / 250mL
Catalog No. 10116287

Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta Invitrogen ™ DAPI and Hoechst Nucleic Acid Sta

187,00 € / 1mL
Catalog No. 17821163

Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech Gibco ™ Human FGF-basic (FGF-2/bFGF) (154 aa) Recombinant Protein, PeproTech

226,00 € / 100µg
Catalog No. 11570806

Invitrogen ™ Wheat Germ Agglutinin (WGA) Invitrogen ™ Wheat Germ Agglutinin (WGA)

656,00 € / 5mg
Catalog No. 17833373

Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech Gibco ™ Human EGF, Animal-Free Recombinant Protein, PeproTech

87,25 € / 100µg
Catalog No. 10181030

Thermo Scientific ™ Protéinase K, recombinante Thermo Scientific ™ Protéinase K, recombinante

44,60 € / 1mL
Catalog No. 10723941

Thermo Scientific ™ ADN ligase T4 (5 U/μl) Thermo Scientific ™ ADN ligase T4 (5 U/μl)

82,75 € / 1000 unités
Catalog No. 10649890

Thermo Scientific ™ DNase I, sans Rnase (1 U/ Thermo Scientific ™ DNase I, sans Rnase (1 U/

76,25 € / 1000 unités

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

DNA Ligase III Antibody - Azide and BSA Free, Novus Biologicals™ > 0.02 mL, Unconjugated

Votre nom

Votre adresse e-mail *

Type de problème *

Description détaillée du problème/de la demande *

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Annuler Soumettre

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis

Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu

DNA Ligase III Antibody - Azide and BSA Free, Novus Biologicals™

Description

Spécification

Suggestions de produits

Documents

Promotions

Derniers produits consultés...Afficher