missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GPRC5A/RAI3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-58188-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
GPRC5A/RAI3 Polyclonal specifically detects GPRC5A/RAI3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Spécification
| GPRC5A/RAI3 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| G protein-coupled receptor, family C, group 5, member A, GPCR5A, Orphan G-protein-coupling receptor PEIG-1, RAI3G-protein coupled receptor family C group 5 member A, RAIG1RAIG-1, retinoic acid induced 3, retinoic acid responsive, Retinoic acid-induced gene 1 protein, retinoic acid-induced protein 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
| GPRC5A | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MATTVPDGCRNGLKSKYYRLCDKAEAWGIVL | |
| 25 μL | |
| GPCR | |
| 9052 | |
| Human | |
| IgG |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
GPRC5A/RAI3 Antibody, Novus Biologicals™ > 25 μL, Unlabeled
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
