missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. Abnova™ Human FOXO1A Partial ORF (NP_002006, 556 a.a. - 655 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human FOXO1A Partial ORF (NP_002006, 556 a.a. - 655 a.a.) Recombinant Protein with GST-tag at N-terminal

Code produit. 16064035
Click to view available options
Quantité:
10 ug
25 ug
Conditionnement:
10µg
25µg
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 16064035

Marque: Abnova™ H00002308Q01.10ug

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Cet article est supprimé, vous trouverez le remplacement et les alternatives dans les onglets respectifs ci-dessous s'ils ont été identifiés
 Voir les produits de remplacement

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Used for AP, Array, ELISA, WB-Re

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma. [provided by RefSeq]

Sequence: TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG

Spécification

Numéro d’adhésion NP_002006
À utiliser avec (application) Antibody Production, ELISA, Protein Array, Western Blot
Formule 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Identification génétique (Entrez) 2308
Poids moléculaire 36.74kDa
Nom FOXO1A (Human) Recombinant Protein (Q01)
Test du contrôle qualité 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantité 10 ug
Immunogène TQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPSDLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
Conditions de stockage Store at -80°C. Aliquot to avoid repeated freezing and thawing.
État réglementaire RUO
Alias de gène FKH1/FKHR/FOXO1A
Nom usuel FOXO1
Symbole de gène(s) FOXO1
Espèces Wheat Germ (in vitro)
Recombinant Recombinant
Marqueur de protéine GST
Système d’expression wheat germ expression system
Forme Liquid
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis