missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
Tous les produits Bio Techne Produits
Click to view available options
Quantité:
5 mg
Conditionnement:
5mg
Spécification
Spécification
| Espèces hôtes | Human, Mouse |
| Composants | TIRAP Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKLQLRDAAPGGAIVS (TIRAP sequence is underlined). Molecular weight: 3701.4. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361. |
| À utiliser avec (application) | Inhibition of TIRAP binding to TLR2 or TLR4 |
| Contenu et stockage | Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. |
| Quantité | 5 mg |
| Type de produit | TIRAP (TLR2 and TLR4) Inhibitor Peptide Set |
| Poids moléculaire | 3701.4 |
| Inhibiteurs | TLR2, TLR4 |
| Forme | Lyophilisé |
Usage exclusivement réservé à la recherche
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu