missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Human PRL R Protein
A cDNA sequence encoding the PRL R was constructed and used to recombinantly synthesize the protein.
131.00€ - 4880.00€
Spécification
| Nom | PRL R Protein |
|---|---|
| État réglementaire | Research Use Only |
| Concentration en endotoxines | < 1.0 EU per ug protein as determined by the LAL method. |
| Activité biologique | Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio. |
| Type de produit | Recombinant Protein |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
15945348
|
enQuireBio™
QP10846-5ug |
5 μg |
131.00€
5µg |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
15935348
|
enQuireBio™
QP10846-20ug |
20 μg |
203.00€
20µg |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
15925348
|
enQuireBio™
QP10846-1mg |
1 mg |
4880.00€
1mg |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Spécification
| PRL R Protein | |
| < 1.0 EU per ug protein as determined by the LAL method. | |
| Recombinant Protein | |
| E. coli | |
| AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW | |
| Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE. (c) Gel filtration at pH 8 under non denaturative conditions. |
| Research Use Only | |
| Activity is determined by the dose-dependant inhibition of Prolactin stimuled proliferation of Nb2 cells and by high affinity binding of ovine Prolactin and other lactogenic hormones in 1:1 molar ratio. | |
| Human | |
| Untagged | |
| The Prolactin Receptor was lyophilized from a concentrated (0.4 mg/ml) solution with 0.0045mM NaHCO3. |