missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human TNFRSF4 Recombinant Protein fused to murine IgG2a Fc purifird from CHO cells
Used for SDS-PAGE
Marque: Abnova™ P4934.25ug
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. [provided by RefSeq]
Sequence: TNFRSF4 mature: lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnctlagkhtlqpasnssdaicedrdppatqpqetqgpparpitvqpteawprtsqgpstrSpécification
| 0.5 mg/mL | |
| Liquid | |
| 45.6kDa | |
| Mammalian cell (CHO) expression system | |
| 25 μg | |
| Store at 4°C. This product is stable for at least 3 months. | |
| ACT35/CD134/OX40/TXGP1L | |
| TNFRSF4 | |
| Recombinant | |
| Mammalian cell (CHO) expression system |
| SDS-PAGE | |
| 7293 | |
| TNFRSF4 (Human) Recombinanat Protein | |
| Size purification | |
| TNFRSF4 mature: lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnctlagkhtlqpasnssdaicedrdppatqpqetqgpparpitvqpteawprtsqgpstr Fused to murine IgG2a Fc: eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg | |
| RUO | |
| TNFRSF4 | |
| Human | |
| None | |
| Liquid |