Learn More
Invitrogen™ Human S100A10 (aa 1-67) Control Fragment Recombinant Protein
Recombinant Protein
Marque: Invitrogen™ RP102006
176.67 EUR valable jusqu'au 2025-03-29
Utilisez le code promo "24111" pour bénéficier de cette offre.
Alert:
Pour que la promotion s’applique, le client doit acheter trois fois le même produit au prix catalogue sur la même commande pour avoir une remise de 33.33%. Il n’y a pas de limite d’achat pour un multiple de 3 produits. PCODE: 24111
Description
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82082 (PA5-82082. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The S-100 family of calcium-activated proteins interact with a range of target proteins to modulate biological signaling pathways. Numerous cancer cell lines overexpress the plasminogen receptor S-100A10 on the extracellular cell surface, where it forms a heterotetrameric complex with Annexin II, though this association is not required for plasma membrane localization or binding and activation of plasminogen. Additionally, S-100A10 acts as a cellular chaperone for hepatitis B (Hep B) virus polymerase. Hep B virus polymerase normally localizes to the cytoplasm only, though in the presence of S-100A10 a portion relocates to the nucleus, implying a role for S-100A10 and intracellular calcium in the process of viral replication.
Spécification
P60903 | |
Blocking Assay, Control | |
6281 | |
100 μL | |
42 C; AA409961; AL024248; Annexin II; annexin II ligand; annexin II ligand, calpactin I, light polypeptide; annexin II tetramer (AIIt) p11 subunit; AN x 2 L; AN x 2 LG; Ca[1 ]; CAL12; Cal1l; calcium binding protein A11 (calgizzarin); calpactin I light chain; Calpactin-1 light chain; cellular ligand of annexin II; CLP11; GP11; MGC111133; MGC133268; Nerve growth factor-induced protein 42 C; OTTHUMP00000015270; P PRSS26; p10; p10 protein; P11; p11 subunit; Protein S100 A10; Protein S100-A10; S100 calcium binding protein A10; S100 calcium binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S100 calcium binding protein A10 (calgizzarin); S100 calcium binding protein A10 (calpactin); S100 calcium-binding protein A10; S100 calcium-binding protein A10 (annexin II ligand, calpactin I, light polypeptide (p11)); S-100 related protein, clone 42 C; S100a10 | |
S100A10 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human S100A10 (aa 1-67) Control Fragment | |
RUO | |
S100A10 | |
Unconjugated | |
Recombinant | |
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKV | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Suggestions de produits
Clients qui ont consulté cet article ont également consulté
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.