missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein
Recombinant Protein
Marque: Invitrogen™ RP91392
176.67 EUR valable jusqu'au 2025-03-29
Utilisez le code promo "24111" pour bénéficier de cette offre.
Alert:
Pour que la promotion s’applique, le client doit acheter trois fois le même produit au prix catalogue sur la même commande pour avoir une remise de 33.33%. Il n’y a pas de limite d’achat pour un multiple de 3 produits. PCODE: 24111
Description
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-64867 (PA5-64867, PA5-51512 (PA5-51512. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The function of this protein remains unknown.
Spécification
| Q9Y3I0 | |
| Blocking Assay, Control | |
| 51493 | |
| 100 μL | |
| 3'-phosphate/5'-hydroxy nucleic acid ligase; AI255213; AI463255; ankyrin repeat domain 54; C22orf28; C5H22orf28; D10Wsu52e; DJ149A16.6; FAAP; focal adhesion-associated protein; HAMAP-Rule:MF_03144}; HSPC117; hypothetical protein HSPC117; hypothetical protein LOC406376; hypothetical protein LOC525106; P55; RNA 2',3'-cyclic phosphate and 5'-OH ligase; RNA-splicing ligase RtcB homolog; RTCB; tRNA-splicing ligase RtcB homolog; tRNA-splicing ligase RtcB homolog {ECO:0000255; zgc:76871 | |
| Rtcb | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RTCB (aa 340-499) Control Fragment | |
| RUO | |
| RTCB | |
| Unconjugated | |
| Recombinant | |
| PDDLDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRP | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Invitrogen™ Human RTCB (aa 340-499) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
