missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human MUC1 Control Fragment Recombinant Protein

Code produit. 30210312
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30210312

Marque: Invitrogen™ RP102279

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (32%), Rat (32%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MUC1 (Mucin 1, Episialin, MAM-6, CA 15-3, PEM and EMA) is a large cell surface mucin glycoprotein expressed by most glandular and ductal epithelial cells and some hematopoietic cell lineages. MUC1 is a transmembrane glycoprotein with a large mucin-like extracellular domain that matures through several intermediate forms generated by proteolysis, and sequential addition and processing of numerous O-linked glycans that are heavily sialylated. MUC1 is highly polymorphic and each allele encodes a product that contains a different number of repeats (between 30 and 90) leading to large differences in molecular weight of the protein. MUC1 is expressed on most secretory epithelium, including mammary gland and some hematopoietic cells, and is expressed abundantly in >90% breast carcinomas and metastases. Transgenic MUC1 has been shown to associate with all four cebB receptors and localize with erbB1 (EGFR) in lactating glands. The MUC1 gene contains seven exons and produces several different alternatively spliced variants. Overexpression, aberrant intracellular localization, and changes in glycosylation of the MUC1 protein have been associated with carcinomas. Multiple alternatively spliced transcript variants that encode different isoforms of the MUC1 gene have been reported, but the full-length nature of only some has been determined. Transgenic MUC-1 has been shown to associate with all four cebB receptors and localize with erbB1 (EGFR) in lactating glands.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion P15941
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 4582
Nom Human MUC1 Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène ADMCKD; ADMCKD1; Breast carcinoma-associated antigen DF3; CA 15-3; Cancer antigen 15-3; carcinoma-associated mucin; CD227; DF3 antigen; EMA; Episialin; H23 antigen; H23AG; J19; KL-6; Krebs von den Lungen-6; MAM6; MCD; MCKD; MCKD1; Medullary cystic kidney disease, autosomal dominant; Muc1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; MUC1-alpha; MUC1-beta; MUC1-CT; MUC1-NT; mucin 1, cell surface associated; mucin 1, transmembrane; Mucin1; mucin-1; Mucin-1 subunit alpha; Mucin-1 subunit beta; peanut-reactive urinary mucin; PEM; PEMT; Polymorphic epithelial mucin; PUM; tumor associated epithelial mucin; tumor-associated epithelial membrane antigen; Tumor-associated mucin
Nom usuel MUC1
Symbole de gène(s) MUC1
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence ASSTPGGEKETSATQRSSVPSSTEKNAVSMTSSVLSSHSPGSGSSTTQGQDVTLAPATEPASGSAATWGQDVTSVPVTRPALGSTTPPAHGVTS
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.