missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Lysozyme (aa 82-147) Control Fragment Recombinant Protein
Recombinant Protein
Marque: Invitrogen™ RP100897
176.67 EUR valable jusqu'au 2025-03-29
Utilisez le code promo "24111" pour bénéficier de cette offre.
Alert:
Pour que la promotion s’applique, le client doit acheter trois fois le même produit au prix catalogue sur la même commande pour avoir une remise de 33.33%. Il n’y a pas de limite d’achat pour un multiple de 3 produits. PCODE: 24111
Description
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111271 (PA5-111271. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes human lysozyme, whose natural substrate is the bacterial cell wall peptidoglycan (cleaving the beta[1-4]glycosidic linkages between N-acetylmuramic acid and N-acetylglucosamine). Lysozyme is one of the anti-microbial agents found in human milk, and is also present in spleen, lung, kidney, white blood cells, plasma, saliva, and tears. Missense mutations in LYZ have been identified in heritable renal amyloidosis.
Spécification
| P61626 | |
| Blocking Assay, Control | |
| 4069 | |
| 100 μL | |
| 1,4-beta-N-acetylmuramidase C; 1700038F02Rik; 4-beta-N-acetylmuramidase C; AI326280; Allergen Gal d IV; bA534G20.1; c-type lysozyme; dystrophin; egg white lysozyme; Gal d 4; KAAG648; LYC2; Lys; Lysm; lysozyme; lysozyme (renal amyloidosis); lysozyme 1; lysozyme 2; lysozyme C; Lysozyme C type M; lysozyme C type P; Lysozyme C, spleen isozyme; lysozyme C-1; Lysozyme C-2; lysozyme C-3; lysozyme d1; lysozyme F1; lysozyme like 1; lysozyme-like 1; lysozyme-like protein 1; lysozyme-like protein 2; Lysz; LYZ; Lyz1; Lyz2; LYZC; LYZD1; LYZF1; LYZL1; Lyzs; Lzm; Lzm-s1; Lzp; Lzp-s; P lysozyme structural; PRO1278; renal amyloidosis; RGD1559869; unnamed protein product; UNQ648/PRO1278 | |
| LYZ | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Lysozyme (aa 82-147) Control Fragment | |
| RUO | |
| Lysozyme | |
| Unconjugated | |
| Recombinant | |
| WCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCG | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Invitrogen™ Human Lysozyme (aa 82-147) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
