missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GAPDH (aa 250-298) Control Fragment Recombinant Protein

Code produit. 30197641
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30197641

Marque: Invitrogen™ RP105174

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

GAPDH (Glyceraldehyde-3-phosphate dehydrogenase) is a catalytic enzyme commonly known to be involved in glycolysis. GAPDH exists as a tetramer of identical 37-kDa subunits and catalyzes the reversible reduction of 1,3-bisphosphoglycerate to glyceraldehyde 3-phosphophate in the presence of NADPH. Apart from playing a key role in glycolysis, GAPDH is ubiquitously expressed and displays other activities unrelated to its glycolytic function. GAPDH is reported to be involved in the processes of DNA replication, DNA repair, nuclear RNA export, membrane fusion and microtubule bundling. Studies provide evidence of GAPDH playing an essential part in gene expression observed in apoptosis and as part of the cellular phenotype of age-related neurodegenerative diseases. Further, GAPDH is involved in other cellular processes ranging from membrane fusion, and neuronal apoptosis in cancer. GAPDH is reported to bind to a variety of other proteins, including the amyloid precursor protein, mutations in which cause some forms of Alzheimer's disease (AD), and the polyglutamine tracts of Huntingtin, the protein product aberrant forms of which are causative of Huntington's disease. Associations between GAPDH, actin and tubulin have also be reported. Since GAPDH is expressed at high levels in most tissues, it is useful as protein loading control in Western Blot analysis.
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion O14556, P04406
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 2597, 26330
Nom Human GAPDH (aa 250-298) Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 38 kDa BFA-dependent ADP-ribosylation substrate; aging-associated gene 9 protein; BARS-38; bb02e05; cb350; cb609; CDABP0047; EC 1.2.1.12; epididymis secretory protein Li 278; epididymis secretory sperm binding protein Li 162 eP; fb71f08; fk58c09; G3PD; G3PDH; GAPD; GAPD2; gapdh; GAPDH2; GAPDH-2; GAPDHS; Gapds; Gapd-s; glceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase; glyceraldehyde 3-phosphate dehydrogenase, testis-specific; glyceraldehyde phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde-3-phosphate dehydrogenase (G3PDH); glyceraldehyde-3-phosphate dehydrogenase 2; glyceraldehyde-3-phosphate dehydrogenase GAPDH; glyceraldehyde-3-phosphate dehydrogenase like-17 protein; glyceraldehyde-3-phosphate dehydrogenase type 2; glyceraldehyde-3-phosphate dehydrogenase, spermatogenic; glyceraldehyde-3-phosphate dehydrogenase, testis-specific; glyceraldehyde-phosphate-dehydrogenase; glycerine aldehyde 3-phosphate dehydrogenase; HEL-S-162 eP; HEL-S-278; HGNC:4141; HSD35; HSD-35; I79_001391; KNC-NDS6; LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase, testis-specific; mg:bb02e05; MGC128279 protein; MGC88685; multifunctional protein, glycolytic enzyme; OK/SW-cl0.12; Peptidyl-cysteine S-nitrosylase GAPDH; similar to glyceraldehyde 3-phosphate dehydrogenase; spermatogenic cell-specific glyceraldehyde 3-phosphate dehydrogenase 2; Spermatogenic glyceraldehyde-3-phosphate dehydrogenase; Unknown (protein for IMAGE:8101613); unnamed protein product; wu:fb33a10; wu:fb71f08; wu:fk58c09; wu:ft80f05; zgc:76908
Nom usuel GAPDH
Symbole de gène(s) GAPDH, GAPDHS
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence EKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAG
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis