missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human CLOCK (aa 696-839) Control Fragment Recombinant Protein
Recombinant Protein
Marque: Invitrogen™ RP100715
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
This gene encodes a protein that belongs to the basic helix-loop-helix (bHLH) family of transcription factors. Polymorphisms within the encoded protein have been associated with circadian rhythm sleep disorders. A similar protein in mice is a circadian regulator that acts as a transcription factor and forms a heterodimer with aryl hydrocarbon receptor nuclear translocator-like to activate transcription of mouse period 1.
Spécification
| O15516 | |
| Blocking Assay, Control | |
| 9575 | |
| 100 μL | |
| RUO | |
| CLOCK | |
| Human | |
| TQDRQIRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQTLSVTQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPD | |
| Liquid |
| ≥5.0 mg/mL | |
| 1M urea, PBS with no preservative; pH 7.4 | |
| CLOCK | |
| -20° C, Avoid Freeze/Thaw Cycles | |
| 5330400M04Rik; bHLHe8; circadian locomoter output cycles kaput; circadian locomoter output cycles kaput protein; circadian locomoter output cycles protein kaput; circadian locomotor output cycles kaput; class E basic helix-loop-helix protein 8; CLOCK; clock circadian regulator; clock homolog; hCLOCK; I79_020252; KAT13D; KIAA0334; mCLOCK; rCLOCK | |
| Unconjugated | |
| Recombinant | |
| E. coli |