missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Protéines recombinantes
  4. 30196011

Invitrogen™ Human CD177 Control Fragment Recombinant Protein

Code produit. 30196011
Click to view available options
Quantité:
100 μl
Conditionnement:
100µL
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Code produit. 30196011

Marque: Invitrogen™ RP109641

Veuillez vous pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (49%), Rat (49%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

CD177 (NB1/HNA-2a and PRV-1 form) is a GPI-anchored glycoprotein present mainly on neutrophils. Its plasma membrane expression is increased during pregnancy and and inflammation or after G-CSF application. Ligand of CD177 has been identified as CD31 (PECAM-1). CD177 participates in neutrophil transmigration and seems to be also a pro-proliferative molecule. The antibodies against CD177 can be involved in neonatal alloimmune neutropenia (NAN).
TRUSTED_SUSTAINABILITY

Spécification

Numéro d’adhésion Q8N6Q3
Concentration ≥5.0 mg/mL
À utiliser avec (application) Blocking Assay, Control
Formule 1 M urea, PBS with no preservative; pH 7.4
Identification génétique (Entrez) 57126
Nom Human CD177 Control Fragment
Quantité 100 μl
État réglementaire RUO
Alias de gène 1190003K14Rik; CD177; CD177 antigen; CD177 molecule; cell surface receptor; HNA2A; HNA-2 A; Human neutrophil alloantigen 2 A; NB1; NB1 glycoprotein; NB1 GP; Pdp3; Polycythemia rubra vera protein 1; PRV1; PRV-1; RGD1562941; UNQ595/PRO1181
Nom usuel CD177
Symbole de gène(s) CD177
Conjugué Unconjugated
Espèces Human
Recombinant Recombinant
Marqueur de protéine His-ABP-tag
Séquence GATHCYDGYIHLSGGGLTTRMSIQGCVAQPSSSLLNHTRQIGIFSVCEKGDEPPPASQHEGGG
Contenu et stockage -20°C, Avoid Freeze/Thaw Cycles
Système d’expression E. coli
Forme Liquid
Pureté ou qualité >80% by SDS-PAGE and Coomassie blue staining
Visa mer Visa mindre
Korrigering av produktinnehåll

Din input är viktig för oss. Fyll i det här formuläret för att ge feedback relaterad till innehållet på denna produkt.

Produkttitel

Genom att klicka på Skicka bekräftar du att du kan bli kontaktad av Fisher Scientific angående feedbacken du har lämnat i detta formulär. Vi kommer inte att dela din information för andra ändamål. All kontaktinformation som tillhandahålls ska också underhållas i enlighet med vår Sekretesspolicy.

Tack! Din feedback har skickats. Fisher Scientific arbetar alltid för att förbättra vårt innehåll åt dig. Vi uppskattar din feedback.