missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human C6orf211 (aa 259-378) Control Fragment Recombinant Protein
Recombinant Protein
Marque: Invitrogen™ RP102000
176.67 EUR valable jusqu'au 2025-03-29
Utilisez le code promo "24111" pour bénéficier de cette offre.
Alert:
Pour que la promotion s’applique, le client doit acheter trois fois le même produit au prix catalogue sur la même commande pour avoir une remise de 33.33%. Il n’y a pas de limite d’achat pour un multiple de 3 produits. PCODE: 24111
Description
Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52211 (PA5-52211. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ARMT1 gene ontology annotations related to this gene include protein carboxyl O-methyltransferase activity.
Spécification
| Q9H993 | |
| Blocking Assay, Control | |
| 79624 | |
| 100 μL | |
| Acidic residue methyltransferase 1; ARMT1; C6orf211; Damage-control phosphatase ARMT1; Protein-glutamate O-methyltransferase; Sugar phosphate phosphatase ARMT1; UPF0364 protein C6orf211 | |
| ARMT1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human C6orf211 (aa 259-378) Control Fragment | |
| RUO | |
| C6orf211 | |
| Unconjugated | |
| Recombinant | |
| LVTDLILADFLLSSELATEVHFYGKTIPWFVSDTTIHDFNWLIEQVKHSNHKWMSKCGADWEEYIKMGKWVYHNHIFWTLPHEYCAMPQVAPDLYAELQKAHLILFKGDLNYRKLTGDRK | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Invitrogen™ Human C6orf211 (aa 259-378) Control Fragment Recombinant Protein > 100 μL; Unlabeled
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu