Learn More
Invitrogen™ Human alpha Amylase 1 (aa 242-300) Control Fragment Recombinant Protein
Recombinant Protein
Marque: Invitrogen™ RP104388
176.67 EUR valable jusqu'au 2025-03-29
Utilisez le code promo "24111" pour bénéficier de cette offre.
Alert:
Pour que la promotion s’applique, le client doit acheter trois fois le même produit au prix catalogue sur la même commande pour avoir une remise de 33.33%. Il n’y a pas de limite d’achat pour un multiple de 3 produits. PCODE: 24111
Description
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
Spécification
P0DUB6 | |
Blocking Assay, Control | |
276 | |
100 μL | |
1,4-alpha-D-glucan glucanohydrolase 1; alpha amylase 1; alpha-amylase 1; Amy1; Amy-1; Amy1a; Amy-1-a; AMY1B; AMY1C; AMY2A; amylase 1, salivary; amylase, alpha 1 A (salivary); amylase, salivary, alpha-1 A; C030014B17Rik; glycogenase; PA; salivary alpha-amylase; salivary amylase; salivary amylase alpha 1 A; salivary and hepatic alpha-amylase | |
AMY1A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human alpha Amylase 1 (aa 242-300) Control Fragment | |
RUO | |
alpha Amylase 1 | |
Unconjugated | |
Recombinant | |
KPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Suggestions de produits
Clients qui ont consulté cet article ont également consulté
Certificats
Un numéro de lot est requis pour afficher les résultats sur les certificats. Pour retrouver le numéro de lot sur des commandes passées, utiliser le menu suivi de commande.
Numéro de lot | Type de certificat | Date | Catalog Number |
---|---|---|---|
AB4586044 | Certificat d’analyse | 07/02/2025 |
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.