GMPS, Mouse anti-Human, Clone: 6B5, Abnova™

Name: GMPS, Mouse anti-Human, Clone: 6B5, Abnova&trade;
Brand: Abnova
SKU: 16139395
Price: 326.00 EUR

Mouse Monoclonal Antibody

Marque: Abnova H00008833-M02.100ug

Code nomenclature Nacres: NA.41

Informations supplémentaires : Poids : 0.00010kg

Code produit. 16139395

Expédition estimée: 22-07-2024
pour voir le stock disponible

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Description

Sequence: QMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSG

Spécification

Antigène	GMPS
Classification	Monoclonal
Conjugué	Unconjugated
Expression	guanine monphosphate synthetase
Alias de gène	-
Espèces hôtes	Mouse
Quantité	100 μg
Primaire ou secondaire	Primary
Espèces cibles	Human
Type de produit	Antibody

Applications	ELISA, Western Blot
Clone	6B5
Formule	In 1x PBS, pH 7.4
Numéro d’ordre du gène	NM_003875
Symboles de gène(s)	GMPS
Immunogène	GMPS (NP_003866, 108 a.a. ∼ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
État réglementaire	RUO
Identification génétique (Entrez)	8833
Contenu et stockage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG1 κ

Suggestions de produits

Description