missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GMPS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
453.55€
Spécification
| Antigène | GMPS |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Espèces hôtes | Rabbit |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18292375
|
Bio-Techne
NBP1-52972 |
100 μL |
453.55€
100µL |
Expédition estimée: 29-07-2024 Connectez-vous pour voir le stock disponible |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | ||||
Description
GMPS Polyclonal specifically detects GMPS in Human samples. It is validated for Western Blot.Spécification
| GMPS | |
| Polyclonal | |
| Rabbit | |
| P49915 | |
| 8833 | |
| Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| EC 6.3.5.2, Glutamine amidotransferase, GMP synthase, GMP synthase [glutamine-hydrolyzing], GMP synthetase, guanine monphosphate synthetase, guanosine 5'-monophosphate synthase, MLL/GMPS fusion protein | |
| GMPS | |
| IgG | |
| 77 kDa |