missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Geminin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
369.00€ - 593.00€
Spécification
| Antigène | Geminin |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Espèces hôtes | Rabbit |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18292353
|
Novus Biologicals
NBP2-56766 |
100 μL |
593.00€
100µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18668028
|
Novus Biologicals
NBP2-56766-25ul |
25 μL |
369.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
Geminin Polyclonal specifically detects Geminin in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Spécification
| Geminin | |
| Polyclonal | |
| Rabbit | |
| Breast Cancer, Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, Nuclear Receptors Coactivators and Corepressors, Stem Cell Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 51053 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GRENELSAGLSKRKHRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| Gem, geminin, geminin, DNA replication inhibitor, RP3-369A17.3 | |
| GMNN | |
| IgG | |
| Affinity Purified |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit