missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ENT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00€ - 572.00€
Spécification
| Antigène | ENT2 |
|---|---|
| Dilution | Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18448701
|
Novus Biologicals
NBP1-85253-25ul |
25ul |
292.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18701584
|
Novus Biologicals
NBP1-85253 |
0.1 mL |
572.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
ENT2 Polyclonal specifically detects ENT2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Spécification
| ENT2 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 3177 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KFARYYLANKSSQAQAQELETKAELLQSDENGIPSSPQKVALTLDLDLEKEPESEPDEPQKPGKPSVFTVFQK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Delayed-early response protein 12, DER12Solute carrier family 29 member 2, ENT2, Equilibrative NBMPR-insensitive nucleoside transporter, Equilibrative nitrobenzylmercaptopurine riboside-insensitive nucleosidetransporter, equilibrative nucleoside transporter 2, HNP3636 kDa nucleolar protein HNP36, Hydrophobic nucleolar protein, 36 kDa, hydrophobic nucleolar protein, 36kD, Nucleoside transporter, ei-type, solute carrier family 29 (nucleoside transporters), member 2 | |
| SLC29A2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit