missing translation for 'onlineSavingsMsg'
Learn More
Learn More
CDS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
292.00€ - 572.00€
Spécification
| Antigène | CDS1 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugué | Unconjugated |
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|---|---|---|---|---|---|---|---|---|---|
| Code produit | Marque | Quantité | Prix | Quantité et disponibilité | |||||
|
18438860
|
Novus Biologicals
NBP1-85894-25ul |
25 μL |
292.00€
25µL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
|
18206106
|
Novus Biologicals
NBP1-85894 |
0.1 mL |
572.00€
0.10mL |
Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant! | |||||
Description
CDS1 Polyclonal specifically detects CDS1 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Spécification
| CDS1 | |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| CDP-DAG synthase 1, CDP-DG synthase 1, CDP-DG synthetase 1, CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1, CDP-diacylglycerol synthase 1, CDP-diglyceride pyrophosphorylase 1, CDP-diglyceride synthase 1, CDP-diglyceride synthetase 1, CDS, CDS 1, CTP:phosphatidate cytidylyltransferase 1, EC 2.7.7.41, phosphatidate cytidylyltransferase 1 | |
| CDS1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry 1:20 - 1:50, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 1040 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:YQYFVCPVEYRSDVNSFVTECEPSELFQLQTYSLPPFLKAVLRQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit