caveolin 1, caveolae protein, 22kDa, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CAV1 protein.

Marque: Abnova H00000857-D01P.100ug

Code nomenclature Nacres: NA.46

Code produit. 16185674

360.00€ / 100µg

Veuillez vous connecter pour pouvoir commander cet article. Besoin d'un compte web? Créer le vôtre dès maintenant!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

The scaffolding protein encoded by this gene is the main component of the caveolae plasma membranes found in most cell types. The protein links integrin subunits to the tyrosine kinase FYN, an initiating step in coupling integrins to the Ras-ERK pathway and promoting cell cycle progression. The gene is a tumor suppressor gene candidate and a negative regulator of the Ras-p42/44 MAP kinase cascade. CAV1 and CAV2 are located next to each other on chromosome 7 and express colocalizing proteins that form a stable hetero-oligomeric complex. By using alternative initiation codons in the same reading frame, two isoforms (alpha and beta) are encoded by a single transcript from this gene. [provided by RefSeq

Sequence: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSALFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTVCDPLFEAVGKIFSNVRINLQKEI

Spécification

Antigène	caveolin 1, caveolae protein, 22kDa
Classification	Polyclonal
Description	Rabbit polyclonal antibody raised against a full-length human CAV1 protein.
Expression	CAV1
Alias de gène	BSCL3/CAV/CGL3/MSTP085/VIP21
Espèces hôtes	Rabbit
Méthode de purification	Affinity Purified
État réglementaire	RUO
Identification génétique (Entrez)	857
Contenu et stockage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Isotype	IgG

Applications	Western Blot
Conjugué	Unconjugated
Formule	PBS with no preservative; pH 7.4
Numéro d’ordre du gène	NM_001753.3
Symboles de gène(s)	CAV1
Immunogène	CAV1 (AAH82246.1, 1 a.a. ∼ 178 a.a) full-length human protein.
Quantité	100 μg
Primaire ou secondaire	Primary
Espèces cibles	Human
Type de produit	Antibody

Suggestions de produits

Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit

Votre nom

Votre adresse e-mail *

Type de problème *

Description détaillée du problème/de la demande *

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Annuler Soumettre

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis

Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu

caveolin 1, caveolae protein, 22kDa, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Description

Spécification

Suggestions de produits

Documents

Promotions