missing translation for 'onlineSavingsMsg'
Learn More
Learn More
alpha Amylase 1 Polyclonal Antibody, Invitrogen™
Rabbit Polyclonal Antibody
Marque: Invitrogen PA578771
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL.
Amylase is an enzyme that catalyses the breakdown of starch into sugars. Amylase is present in human saliva, where it begins the chemical process of digestion. By in situ hybridization combined with high resolution cytogenetics, the amylase gene is mapped to 1p21. Amylase enzymes find use in bread making and to break down complex sugars such as starch (found in flour) into simple sugars. Yeast then feeds on these simple sugars and converts it into the waste products of alcohol and CO2.
Spécification
| alpha Amylase 1 | |
| Polyclonal | |
| Unconjugated | |
| AMY1A | |
| 1,4-alpha-D-glucan glucanohydrolase 1; alpha amylase 1; alpha-amylase 1; Amy1; Amy-1; Amy1a; Amy-1-a; AMY1B; AMY1C; AMY2A; amylase 1, salivary; amylase, alpha 1A (salivary); amylase, salivary, alpha-1A; C030014B17Rik; glycogenase; PA; salivary alpha-amylase; salivary amylase; salivary amylase alpha 1A; salivary and hepatic alpha-amylase | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 11722, 24203, 276 | |
| -20°C | |
| Lyophilized |
| Immunohistochemistry (Paraffin), Western Blot | |
| 500 μg/mL | |
| PBS with 5MG BSA and 0.05MG sodium azide | |
| P00687, P0DUB6 | |
| Amy1, AMY1A | |
| A synthetic peptide corresponding to a sequence at the N-terminus of human Alpha Amylase 1 (20-50aa NTQQGRTSIVHLFEWRWVDIALECERYLAPK). | |
| 100 μg | |
| Primary | |
| Human, Mouse, Rat | |
| Antibody | |
| IgG |